PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013638203.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 396aa    MW: 45748.1 Da    PI: 7.368
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013638203.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix88.47.9e-2878159286
        trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     W ++e++ Li +rr m+  ++++k++k+lWee+s+kmre+gf rsp++C++kw+nl k+ykk k++++++   +s +++y++++e
  XP_013638203.1  78 WVQDETRSLIMFRRGMDGLFNTSKSNKHLWEEISAKMREKGFDRSPTMCTDKWRNLLKEYKKAKHHDRGN---VSAKMSYYKEIE 159
                     ********************************************************************95...77889****998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-468139IPR009057Homeodomain-like
PROSITE profilePS500908.07270134IPR017877Myb-like domain
SMARTSM007170.009574136IPR001005SANT/Myb domain
CDDcd122039.16E-3176141No hitNo description
PfamPF138371.0E-2077160No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MFVSDKPRPN DFYKDDNTNS STAARNMIID GDLQPHNQNH HHHNQHHHNH LQPQQILLRE  60
SSGEDHEVKA PKKRAETWVQ DETRSLIMFR RGMDGLFNTS KSNKHLWEEI SAKMREKGFD  120
RSPTMCTDKW RNLLKEYKKA KHHDRGNVSA KMSYYKEIED ILRERSKKVT QYSKSPNTPP  180
IAKVDSFMQF TDKGFDDPSI SFGSVEANGR PGLNLERSLD HDGHPLAITT VDAVPANGVP  240
PWNWRETPGN GGDAHGQPFG GRVITVKFGD YTRRIGIDGT AEAIKETIRS AFRLRTRRAF  300
WLEDEDQVVR CLDRDMPLGN YLLHVDGGVA IRVCHYDESN QLPVHTEEKI FYTEEDYRDF  360
LARRGWTYLQ VDGFRNIDNM DDLQAGAVYR GVRERM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A8e-5472157186DNA binding protein GT-1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00004PBMTransfer from 920224Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2283050.0AK228305.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-74-C23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638203.10.0PREDICTED: trihelix transcription factor GT-1-like
SwissprotQ9FX530.0TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA0A0D3C9T70.0A0A0D3C9T7_BRAOL; Uncharacterized protein
STRINGBra019721.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28912768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.10.0Trihelix family protein